PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1277610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 283aa    MW: 32142.2 Da    PI: 7.233
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1277610.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.11.9e-5491341128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+v+yL+++v+++++++  +i+evdiyk++Pw+Lp k++ +ekewyfFs+r++ky++g r+nra+ sgyWkatg+dk+++s
  Lj2g3v1277610.1   9 LPPGFRFHPTDEELIVHYLCNQVSSHPCPA-PIIPEVDIYKFDPWELPDKTAFGEKEWYFFSPRERKYPNGARPNRAAVSGYWKATGTDKSIFS 101
                      79***************************9.88***************888889**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++vg+kk Lvfykg+ pkg+ktdW+mheyrl
  Lj2g3v1277610.1 102 -GSQHVGVKKALVFYKGKPPKGVKTDWIMHEYRL 134
                      .99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-666161IPR003441NAC domain
PROSITE profilePS5100561.0259161IPR003441NAC domain
PfamPF023651.3E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MEGSSSSELP PGFRFHPTDE ELIVHYLCNQ VSSHPCPAPI IPEVDIYKFD PWELPDKTAF  60
GEKEWYFFSP RERKYPNGAR PNRAAVSGYW KATGTDKSIF SGSQHVGVKK ALVFYKGKPP  120
KGVKTDWIMH EYRLIGTTTQ PPRQIGSMRL DDWVLCRIYK KKATANSLEV KEEEYPTTPI  180
DLKRANEECE QKIDLKFPRT NSLANLLDVD YLGSISHILS DGSYNSTFDF QLNSAHGGTD  240
PLQLMEMPTN SSYAADSGKL QVKRNNTINP TIFVKQDYDH RGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-77916620173NAC domain-containing protein 19
3swm_B2e-77916620173NAC domain-containing protein 19
3swm_C2e-77916620173NAC domain-containing protein 19
3swm_D2e-77916620173NAC domain-containing protein 19
3swp_A2e-77916620173NAC domain-containing protein 19
3swp_B2e-77916620173NAC domain-containing protein 19
3swp_C2e-77916620173NAC domain-containing protein 19
3swp_D2e-77916620173NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.174640.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1384760.0BT138476.1 Lotus japonicus clone JCVI-FLLj-13K17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236855.11e-156NAC domain protein NAC1
SwissprotO492551e-106NAC29_ARATH; NAC transcription factor 29
TrEMBLI3SDC90.0I3SDC9_LOTJA; Uncharacterized protein
STRINGGLYMA01G06150.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-107NAC-like, activated by AP3/PI